DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and prx-6

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_504268.1 Gene:prx-6 / 266912 WormBaseID:WBGene00004195 Length:720 Species:Caenorhabditis elegans


Alignment Length:283 Identity:63/283 - (22%)
Similarity:108/283 - (38%) Gaps:103/283 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 WENL--IYETGLKEKLLKFALSALMFSEHRVDTNVIACNRL----ILLHGPPGTGKTSLCKALAQ 188
            ||::  :.||  |:.:|:           .:.||:.....|    |:|:|.||.|||.:.||:|.
 Worm   464 WEDVGGLEET--KQTVLE-----------SIRTNLFGSRALKRSGIILYGSPGCGKTLIAKAVAT 515

  Fly   189 KLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLA 252
            :..|.         .:.:....|.:|:..:|.:.:.::|.:..:  :.|    ||: .||::|||
 Worm   516 EFKIA---------FLSVKGPELLNKYVGQSEENLRKVFERAKQ--ASP----CVIFFDEIDSLA 565

  Fly   253 YARSAMSSNEPRDA------MRVVNAVLTQLDSLKTCP--NVLILATSNLAQSID---------- 299
                   .|..|:.      .|:|:.:|.:||.|...|  .|.::..:|....:|          
 Worm   566 -------PNRGRNGDSGGVIDRIVSQLLAELDKLHNSPLTKVFVMGATNRPDLLDNSLMTPGRFD 623

  Fly   300 ------------------------LAFVDRADIR--------------LF--IGYPGISAIREIY 324
                                    :.|.:..|:|              ||  |...|::||.|..
 Worm   624 KLVEVKPGEDVESKTKILEAVSRKMRFEEDVDLREIASKVDEKMSGAQLFSIISNAGMAAIVETI 688

  Fly   325 KGM---LAELMSAGVLQREVLES 344
            :.:   ..|..|..|.||.:|||
 Worm   689 QSIEDGKTENQSIRVAQRHLLES 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 43/211 (20%)
AAA 169..314 CDD:278434 42/203 (21%)
prx-6NP_504268.1 CDC48 <261..714 CDD:273521 63/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.