DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and CG31495

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:261 Identity:55/261 - (21%)
Similarity:104/261 - (39%) Gaps:72/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 GLKEKLLKFALSALMFSEHRVDTNVI--------ACNRLILLHGPPGTGKTSLCKALAQKLSIRT 194
            |.:|:.|:..:..........|.|.:        :|:   |:.|.|.:|.|:    :|.:::::|
  Fly    92 GRQEETLQLLMPYEYLDRTAFDPNDLLSTGRPRWSCH---LVEGKPKSGLTT----VAAQMALKT 149

  Fly   195 QGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDP--NNLVCVLIDEVES-LAYARS 256
            ...:    :..|:|..|..  .|:|.|.     .:|.|::.|.  :...||:||:.|. :.|  .
  Fly   150 DCPF----IKYISSAELLG--LSDSEKC-----QRIREVLEDAYVSRRSCVIIDDFERVIGY--G 201

  Fly   257 AMSSNEPRDAMRVVNAVLTQLDSLKTCPN---VLILATSNLAQSIDLAFVDRADIRLFIG----- 313
            |:.....::.::.:..:|.     |..||   ::|:.|||           |.|:...:|     
  Fly   202 ALGKRYSKEFLQKLTVLLK-----KQPPNSHELIIICTSN-----------RLDVLEELGLLSVF 250

  Fly   314 -----YPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKLPLL 373
                 .|.:|..:|:   |:....|......|:.:.|.|.:|     ...|:|:.    |.|.|:
  Fly   251 TSVHNVPNVSTPKEL---MVIVEASKRFEPEELRQIEIAMDG-----RNVSIGIK----RLLDLI 303

  Fly   374 A 374
            |
  Fly   304 A 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 34/164 (21%)
AAA 169..314 CDD:278434 34/160 (21%)
CG31495NP_001287320.1 AAA 129..259 CDD:214640 35/162 (22%)
P-loop_NTPase 129..257 CDD:304359 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.