DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and cdc-48.1

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_496273.1 Gene:cdc-48.1 / 174624 WormBaseID:WBGene00007352 Length:809 Species:Caenorhabditis elegans


Alignment Length:246 Identity:73/246 - (29%)
Similarity:109/246 - (44%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR 193
            |.|.:.|.....||.|||.:..               :|.:|.:||||.|||.|.||:|.:    
 Worm   495 LQELVQYPVEHPEKYLKFGMQP---------------SRGVLFYGPPGCGKTLLAKAIANE---- 540

  Fly   194 TQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSA 257
                 ...:.:.|....|.:.||.||...|..:|:|......      ||| .||::|:|.||..
 Worm   541 -----CQANFISIKGPELLTMWFGESEANVRDVFDKARAAAP------CVLFFDELDSIAKARGG 594

  Fly   258 MSSNEPRDAM-RVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISA 319
            .:..:...|. ||:|.|||::|.:....||.|:..:|....||.|.:  .|.|..::|..|..::
 Worm   595 GAGGDGGGASDRVINQVLTEMDGMNAKKNVFIIGATNRPDIIDPAVLRPGRLDQLIYIPLPDEAS 659

  Fly   320 IREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL 370
            ..:|.|..|          |:...|:|.:   ||.||:.:||.||..|.::
 Worm   660 RHQILKASL----------RKTPLSKDLD---LTFLAKNTVGFSGADLTEI 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 49/152 (32%)
AAA 169..314 CDD:278434 48/148 (32%)
cdc-48.1NP_496273.1 CDC48_N 31..112 CDD:280513
CDC48 52..775 CDD:273521 73/246 (30%)
CDC48_2 137..197 CDD:215011
AAA 247..376 CDD:278434
AAA 520..654 CDD:278434 48/148 (32%)
Vps4_C <727..771 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.