DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and SPATA5

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_016863314.1 Gene:SPATA5 / 166378 HGNCID:18119 Length:917 Species:Homo sapiens


Alignment Length:392 Identity:98/392 - (25%)
Similarity:149/392 - (38%) Gaps:133/392 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ASHALLPAAQFVGLWENLIYE--TGLK----------------EKLLKFALSA------------ 150
            ||..||...|..|....|:.|  ||||                |:||||::.|            
Human   264 ASDVLLDVTQSPGDGSGLMLEEVTGLKCNFESAREGNEQLTEEERLLKFSIGAKCNTDTFYFISS 328

  Fly   151 ---LMFSEHRVDTNV------------------------------------------IACNRLIL 170
               :.|:|  :|.|.                                          |...|.:|
Human   329 TTRVNFTE--IDKNSKEQDNQFKVTYDMIGGLSSQLKAIREIIELPLKQPELFKSYGIPAPRGVL 391

  Fly   171 LHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVS 235
            |:||||||||.:.:|:|.::     |:|...    ||...:.||::.|:...:.|:|.:..  :.
Human   392 LYGPPGTGKTMIARAVANEV-----GAYVSV----INGPEIISKFYGETEAKLRQIFAEAT--LR 445

  Fly   236 DPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSLKTCPN---VLILATSNLAQS 297
            .|:   .:.|||:::|...|.. :.||..  .|||.::||.:|.:.:..:   ||:|..:|...:
Human   446 HPS---IIFIDELDALCPKREG-AQNEVE--KRVVASLLTLMDGIGSEVSEGQVLVLGATNRPHA 504

  Fly   298 IDLAF--VDRADIRLFIGYPGISAIREIYKGMLAE----LMSAGVLQ------------REVLES 344
            :|.|.  ..|.|..:.||.|......:|.:.:|..    |..|.:||            .:||.:
Human   505 LDAALRRPGRFDKEIEIGVPNAQDRLDILQKLLRRVPHLLTEAELLQLANSAHGYVGADLKVLCN 569

  Fly   345 EDAEEGLL----------TQLAERSVGLSG--RTLRKLPLLAHAQYTSSTLFELDQKISLSDFLD 397
            |.|...:|          |.|.:...||..  |.|:|.|.|...:.....      ||:|.|||.
Human   570 EAAGTRILKAHMYVSAFATGLTQTPQGLCALRRILKKQPNLPDVKVAGLV------KITLKDFLQ 628

  Fly   398 AM 399
            ||
Human   629 AM 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 46/153 (30%)
AAA 169..314 CDD:278434 44/149 (30%)
SPATA5XP_016863314.1 CDC48_N 65..133 CDD:389870
CDC48 <323..913 CDD:273521 80/333 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.