DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and Pex6

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_476466.1 Gene:Pex6 / 117265 RGDID:621637 Length:978 Species:Rattus norvegicus


Alignment Length:360 Identity:83/360 - (23%)
Similarity:146/360 - (40%) Gaps:80/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EEGQL---GL-FSGEEGSDGIDSIVAASHALLPAAQFVGL-WENLIYETGLKEKLLKFALSALMF 153
            :||:|   |. ...|:....:|.:..|....:.|.:...: |    ::.|..:.:.|..|..:..
  Rat   661 DEGELCAAGFPLLAEDFGQALDQLQTAHSQAVGAPKIPSVSW----HDVGGLQDVKKEILETIQL 721

  Fly   154 SEHRVDTNVIACNRL-ILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFS 217
            .....:...:...|. :|||||||||||.|.||:|.:.|:.         .:.:....|.:.:..
  Rat   722 PLEHPELLSLGLRRSGLLLHGPPGTGKTLLAKAVATECSLT---------FLSVKGPELINMYVG 777

  Fly   218 ESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSAMSSNEPRDAM-RVVNAVLTQLDSL 280
            :|.:.|.::|.:......      |:: .||::|||.:|.  .|.:....| |||:.:|.:||.|
  Rat   778 QSEENVREVFARARAAAP------CIIFFDELDSLAPSRG--RSGDSGGVMDRVVSQLLAELDGL 834

  Fly   281 KTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPG--------ISAIREIYKGMLAELMSAG 335
            .:..:|.::..:|....:|.|.:  .|.|..:|:|...        :|||...:|      :.|.
  Rat   835 HSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRKFK------LEAS 893

  Fly   336 VLQREVLE-------SED----AEEGLLTQLAER----SVGLSGRTLRKLPLLAHAQYTSSTLFE 385
            |....||:       ..|    ..:.::|.|..|    ..||..|              ||.|. 
  Rat   894 VSLMNVLDCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEGLEPR--------------SSALL- 943

  Fly   386 LDQKISLSDFLDAMLEALEQHLGEQRLLKLESMEQ 420
                :::.|.|.|... |:..:.||.||:.:.:::
  Rat   944 ----LTMEDLLQAAAR-LQPSVSEQELLRYKRIQR 973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 45/153 (29%)
AAA 169..314 CDD:278434 43/148 (29%)
Pex6NP_476466.1 SpoVK 463..965 CDD:223540 81/350 (23%)
AAA 466..595 CDD:278434
AAA 741..869 CDD:278434 41/144 (28%)
Vps4_C 923..975 CDD:286426 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.