DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pch2 and spata5

DIOPT Version :9

Sequence 1:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_004911173.2 Gene:spata5 / 100494828 XenbaseID:XB-GENE-6054426 Length:872 Species:Xenopus tropicalis


Alignment Length:256 Identity:70/256 - (27%)
Similarity:114/256 - (44%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 RLILLHGPPGTGKTSLCKALAQKLSIRTQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIA 231
            |.:||:||||||||.:.:|:|.::.         .|:..||...:.||::.||...:.|:|...:
 Frog   369 RGVLLYGPPGTGKTLIARAIANEVG---------AHVTVINGPEIVSKFYGESEARLRQIFADAS 424

  Fly   232 ELVSDPNNLVCVLIDEVESLAYARSAMSSNEPRDAMRVVNAVLTQLDSL---KTCPNVLILATSN 293
            :....     .:.|||:::|...|.. :.||..  .|||.::||.:|.:   ::...:|:|..:|
 Frog   425 QCCPS-----IIFIDELDALCPKREG-AQNEVE--KRVVASLLTLMDGIGSEESQGQLLVLGATN 481

  Fly   294 LAQSIDLAF--VDRADIRLFIGYPGISAIREIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLA 356
            ...|:|.|.  ..|.|..:.||.|......:|.:.:|.::...       |:.||     |.|||
 Frog   482 RPHSLDPALRRPGRFDKEIEIGVPNAQGRLDILQKVLKKVPHR-------LKEED-----LAQLA 534

  Fly   357 ERSVGLSG----------------RTLRKLPLLAHAQYTSSTLFELDQKISLSDFLDAMLE 401
            :|:.|..|                ||.|.|...:..:...|.:      |:|:|||.|..|
 Frog   535 DRTHGYVGADLAALCKEAGMNALRRTHRVLSRPSDREMAGSVV------ITLNDFLQATNE 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pch2NP_001287235.1 AAA 166..315 CDD:214640 45/152 (30%)
AAA 169..314 CDD:278434 43/149 (29%)
spata5XP_004911173.2 CDC48 <309..868 CDD:273521 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.