DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or19a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:272 Identity:57/272 - (20%)
Similarity:109/272 - (40%) Gaps:67/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LVCDFWLGM----RQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADML----M 228
            |.|...||:    ...|..|.|..|:||:|....|.|                 ||..||    :
  Fly   137 LACTVVLGIIYISASSEPTLMYPTWIPWNWRDSTSAY-----------------LATAMLHTTAL 184

  Fly   229 CALVTLVV-------MHFIRLSAHIES---HVAGIG---------------SFQHDLEFLQATVA 268
            .|..|||:       .:.|.:|.|.::   .|:.:|               .:.||         
  Fly   185 MANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHD--------- 240

  Fly   269 YHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGS----KIDNLVMLVLFLFCAMVQV 329
             ||.::.|.:.:.....::....|.|::...|.:.:.:..|:    :..|::.|::.|   ..:.
  Fly   241 -HQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVIL---TTET 301

  Fly   330 FMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSD 394
            .::...|:......|.:..|||:.:|....:.:|::|:|::.|.|.|..|.:.:.:.||:.|.:.
  Fly   302 LLLCYTAELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTV 366

  Fly   395 LLQLSYKFFALL 406
            :::.:|....||
  Fly   367 MIKGAYTMLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 54/264 (20%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 54/264 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.