DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or98b

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:241 Identity:49/241 - (20%)
Similarity:91/241 - (37%) Gaps:27/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHI 246
            :.:...|:....|||.....:|...|..............:..|.|.|:|...:...| :::.|.
  Fly   156 ELQPKFPFPSVYPWDNMKLSNYIISYFWNVCAALGVALPTVCVDTLFCSLSHNLCALF-QIARHK 219

  Fly   247 ESHVAGIGSFQHDLEFLQATVAYHQSLIH------LCQD----INEIFGVSLLSNFVSSSFIICF 301
            ..|..|           :.|...|::|.|      ||.:    :||.|. .|:..||::|..:|.
  Fly   220 MMHFEG-----------RNTKETHENLKHVFQLYALCLNLGHFLNEYFR-PLICQFVAASLHLCV 272

  Fly   302 VGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKML 366
            :.:|::.......|:....|....:.||.:.......:....:..|||:|...|... |:....|
  Fly   273 LCYQLSANILQPALLFYAAFTAAVVGQVSIYCFCGSSIHSECQLFGQAIYESSWPHL-LQENLQL 336

  Fly   367 ILIIKRAQQPSRLKATM---FLNISLVTVSDLLQLSYKFFALLRTM 409
            :..:|.|...|.|...:   |...:..|:..:::.:..:..|||::
  Fly   337 VSSLKIAMMRSSLGCPIDGYFFEANRETLITIVRTAISYVTLLRSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 46/230 (20%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 46/229 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.