DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or98a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:398 Identity:76/398 - (19%)
Similarity:143/398 - (35%) Gaps:82/398 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIYV----FLAIGKGSNFLEATMNL 92
            ||.||::                   |:...::||...:||:.|    |.::|.....|      
  Fly    57 YLPIGII-------------------ISFKTDINTFTPNELLTVMQLFFNSVGMPFKVL------ 96

  Fly    93 SFIGFVIVGDFKIWN-ISRQRKRLTQVVSRLEELHPQGLAQ-QEPYNIGHHLSGYSRYSKFYFGM 155
             |....|.|.:|... :|...||.|.:..|: |:| ||:.: .:.|.|...:     |:.:....
  Fly    97 -FFNLYISGFYKAKKLLSEMDKRCTTLKERV-EVH-QGVVRCNKAYLIYQFI-----YTAYTIST 153

  Fly   156 HMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSG 220
            .:....:..|.|.:|....||......|           |..:...:...::         .::.
  Fly   154 FLSAALSGKLPWRIYNPFVDFRESRSSF-----------WKAALNETALMLF---------AVTQ 198

  Fly   221 QLAADM--LMCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEI 283
            .|.:|:  |:..|:..|.:..:||  .:||.....|....:.|         |.||...:|.|.|
  Fly   199 TLMSDIYPLLYGLILRVHLKLLRL--RVESLCTDSGKSDAENE---------QDLIKCIKDHNLI 252

  Fly   284 FG-VSLLSNFVSSSFIICFVGFQMTIGSKIDNLVML---------VLFLFCAMVQVFMIATHAQR 338
            .. .:.:...|:.:..:.|:...:.:|..:.||:..         |.::...|||.|........
  Fly   253 IDYAAAIRPAVTRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDL 317

  Fly   339 LVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFF 403
            |....|.:..|:::.:|..:...|:..|...:|.||:.....|.....||..:...:.:|::...
  Fly   318 LKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVV 382

  Fly   404 ALLRTMYV 411
            ..:..:.:
  Fly   383 TFVNQLNI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 64/329 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 69/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465992
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.