DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or94a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:423 Identity:87/423 - (20%)
Similarity:177/423 - (41%) Gaps:70/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KEQEKLKAIPLHSFLKYANVFYLSIGMMAYDHKYSQKWK---------EVLLH----WTFIAQM- 61
            |.:::::::.|  .|:...:|    |:..:..|..::|.         ..|||    :|||..| 
  Fly     3 KHKDRIESMRL--ILQVMQLF----GLWPWSLKSEEEWTFTGFVKRNYRFLLHLPITFTFIGLMW 61

  Fly    62 ----VNLNTVLISELIYVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRL 122
                ::.|.....:::|               |:::.:..|:    ||.:|...|....:::..|
  Fly    62 LEAFISSNLEQAGQVLY---------------MSITEMALVV----KILSIWHYRTEAWRLMYEL 107

  Fly   123 EELHPQGLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERML 187
            :......|..||..:....   ..|:.|::|.::::      :...|.|..|...|.:..:|  |
  Fly   108 QHAPDYQLHNQEEVDFWRR---EQRFFKWFFYIYIL------ISLGVVYSGCTGVLFLEGYE--L 161

  Fly   188 PYYCWVPWDWSTGYSYYFMYISQNIGGQ--ACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHV 250
            |:..:||::|.....|:|.| ..::.|.  .|:| .:..|.|.|    ..:.|...|...:...:
  Fly   162 PFAYYVPFEWQNERRYWFAY-GYDMAGMTLTCIS-NITLDTLGC----YFLFHISLLYRLLGLRL 220

  Fly   251 AGIGSFQHDLEF---LQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMT-IGSK 311
            ....:.::|..|   |:|....||.:..|......|....:||..:.|:.||||.|:::. :|.:
  Fly   221 RETKNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIR 285

  Fly   312 IDN---LVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRA 373
             ||   .:.::.|:...::|:::...:...:...:.|:...||:.:|.......||:|...::..
  Fly   286 -DNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHL 349

  Fly   374 QQPSRLKATMFLNISLVTVSDLLQLSYKFFALL 406
            ::|..::|..|..:.|......:..:|.|.|||
  Fly   350 KKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 66/324 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 68/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.