DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or83c

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:229 Identity:40/229 - (17%)
Similarity:94/229 - (41%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 YCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIR---LSAHIESHV- 250
            ||:|       .:|....::..:.|....||.|...:.:..::|...|..::   |:..:|... 
  Fly   176 YCYV-------VTYMIQTVTMLVQGVGFYSGDLFVFLGLTQILTFADMLQVKVKELNDALEQKAE 233

  Fly   251 --------AGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMT 307
                    |.|...::....|...:.:||.....|:.||.:: ..|::..|.|..:...:.|.:.
  Fly   234 YRALVRVGASIDGAENRQRLLLDVIRWHQLFTDYCRAINALY-YELIATQVLSMALAMMLSFCIN 297

  Fly   308 IGS-KIDNLVMLV-----LFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKML 366
            :.| .:.:.:..|     :.::|.:..:         |..|.:|:.:::.|..|:......||:.
  Fly   298 LSSFHMPSAIFFVVSAYSMSIYCILGTI---------LEFAYDQVYESICNVTWYELSGEQRKLF 353

  Fly   367 ILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSY 400
            ..:::.:|.|..::....:::|:.|...:::|.|
  Fly   354 GFLLRESQYPHNIQILGVMSLSVRTALQIVKLIY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 39/227 (17%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 39/227 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.