DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or74a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:273 Identity:50/273 - (18%)
Similarity:107/273 - (39%) Gaps:77/273 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 LYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMC 229
            |::.:..||.:||:|                          ..|:..:.|:..:.|:|       
  Fly   180 LHFFIPLLVLNFWVG--------------------------FIITSMLFGELNVMGEL------- 211

  Fly   230 ALVTLVVMH----FIRLSAHIESHVAGIGSFQHDLE---FLQATVAYHQSLIHLC---------- 277
                  :||    :|:|...:..      |.|..|:   .|...:||..:|.|:.          
  Fly   212 ------MMHLNARYIQLGQDLRR------SAQMLLKKSSSLNVAIAYRLNLTHILRRNAALRDFG 264

  Fly   278 QDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVLFL--FCAMVQVFMIATHAQRLV 340
            |.:.:.|.:.:...|..|:.::|.:.|: ...:...|:..:|.||  |..::.:.|:.:   .|:
  Fly   265 QRVEKEFTLRIFVMFAFSAGLLCALFFK-AFTNPWGNVAYIVWFLAKFMELLALGMLGS---ILL 325

  Fly   341 DASEQIGQAVYNHDWFRA---------DLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLL 396
            ..::::|...|..||.:.         :::..|::.|.|:...:|..:....:..:||..|..::
  Fly   326 KTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQLNSRPFFITGLNYFRVSLTAVLKII 390

  Fly   397 QLSYKFFALLRTM 409
            |.::.:|..|.:|
  Fly   391 QGAFSYFTFLNSM 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 47/262 (18%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 47/262 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.