DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or71a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:435 Identity:85/435 - (19%)
Similarity:168/435 - (38%) Gaps:111/435 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKDTQSAKEQEKLKAIPLHSFLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVL 68
            :|::.|..:....:|..||  :.:..:|.|.:.:.|...:..|...:|||        :.|.|..
  Fly    24 RKESVSTPDWTNWQAYALH--VPFTFLFVLLLWLEAIKSRDIQHTADVLL--------ICLTTTA 78

  Fly    69 ISELI-----YVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQ 128
            :...:     |..:|.|                  |:.::..|::...|.:....:.|.|     
  Fly    79 LGGKVINIWKYAHVAQG------------------ILSEWSTWDLFELRSKQEVDMWRFE----- 120

  Fly   129 GLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQF---------E 184
                            :.|:::.:                ::|.:|.  .|:..|         .
  Fly   121 ----------------HRRFNRVF----------------MFYCLCS--AGVIPFIVIQPLFDIP 151

  Fly   185 RMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESH 249
            ..||::.|.|:||.....:::.:|.|    ...:....|.::.|.|:...:::|   ||..:...
  Fly   152 NRLPFWMWTPFDWQQPVLFWYAFIYQ----ATTIPIACACNVTMDAVNWYLMLH---LSLCLRML 209

  Fly   250 VAGIGSFQHD-----LEFLQATVAYHQSLIHLCQDIN------EIF-GVSLLSNFVSSSFIICFV 302
            ...:...|||     .:||:        ||||.|.:.      ||| ..|..:..:.||.||||.
  Fly   210 GQRLSKLQHDDKDLREKFLE--------LIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFT 266

  Fly   303 GFQMTIGSKIDNL---VMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRK 364
            .:.|.:...:.:|   ..::.:|...::||.:...:...::|::..:..::||.||...:.|.|:
  Fly   267 IYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRR 331

  Fly   365 MLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409
            ::::.:....:|..|||..|.:|.|...:..:..:|...|||..|
  Fly   332 LVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNM 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 63/339 (19%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 71/378 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466184
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.