DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or63a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:443 Identity:88/443 - (19%)
Similarity:190/443 - (42%) Gaps:70/443 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAKEQEKLKAIPLHSFLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTV-----L 68
            |.:|..:||.....|..:...:.| ::|....|   ..:..:||..||.:..:.:|.::     :
  Fly     3 SPEEAAELKRRNYRSIREMIRLSY-TVGFNLLD---PSRCGQVLRIWTIVLSVSSLASLYGHWQM 63

  Fly    69 ISELIYVFLAIGK-GSNFLEATMNLSFIGFVIVGDFKIWNISRQRK-----RLTQVVSRLEELHP 127
            ::..|:....||: ....|:...:::.:.:.:....:|:.:.|:.:     :..::..|:.:| |
  Fly    64 LARYIHDIPRIGETAGTALQFLTSIAKMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDL-P 127

  Fly   128 --QGLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYN-LYWAVYYLVCDFWLGM-RQFER--- 185
              :.:.||....:..:.:...|         .:||:.|: :.....|.:..|.:.: |.|.:   
  Fly   128 VIKEIRQQVESTMNRYWASTRR---------QILIYLYSCICITTNYFINSFVINLYRYFTKPKG 183

  Fly   186 ----MLP----YYCWVPWDWSTGYSYYFMYISQNIGGQAC---LSGQLAADMLMCAL----VTLV 235
                |||    |..|........|.:..||:      :.|   :.|       |||:    |.:|
  Fly   184 SYDIMLPLPSLYPAWEHKGLEFPYYHIQMYL------ETCSLYICG-------MCAVSFDGVFIV 235

  Fly   236 V-MHFI----RLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSS 295
            : :|.:    .|:..:|...:.:......:|:|:..:..:|.:.:...::|..|.....:.|:.|
  Fly   236 LCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHITFTQFLLS 300

  Fly   296 SFIICFVGFQMTIG----SKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWF 356
            .|......|||::|    |.| .::.:.::|..|..|:.:...:.||...|||:|..|.|...|:
  Fly   301 LFNWGLALFQMSVGLGNNSSI-TMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWY 364

  Fly   357 RADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409
            .....:|.::.:::.|..:..||..:.|:.:||.|:..:::.|.::|.||:.:
  Fly   365 GESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 68/351 (19%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 68/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.