DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or59b

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:435 Identity:89/435 - (20%)
Similarity:156/435 - (35%) Gaps:125/435 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLHSFLKYA-----------NVFYLSIGMMAYDHKYSQKWK-----EVLLHWTFIAQMVNLNTVL 68
            |....|:|.           .||||.:|.:.   .|.|::|     |.|   |.:...:|:....
  Fly    37 PKEGVLRYVYLFWTCVPFAFGVFYLPVGFII---SYVQEFKNFTPGEFL---TSLQVCINVYGAS 95

  Fly    69 I-SELIYVFL-AIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLA 131
            : |.:.|:|| .:.|....|::.            |.::.|.| .|:|:..:|:|..        
  Fly    96 VKSTITYLFLWRLRKTEILLDSL------------DKRLANDS-DRERIHNMVARCN-------- 139

  Fly   132 QQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLY----WAVYYLVCDFWLGMRQFERMLPYYCW 192
                       ..:..||..|.|.......:|.|.    |:||....|:..||...        |
  Fly   140 -----------YAFLIYSFIYCGYAGSTFLSYALSGRPPWSVYNPFIDWRDGMGSL--------W 185

  Fly   193 VPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGIGSFQ 257
            :        ...|.||:.:.   |.|..||:.        |..:|..|...||:|.....:.|.:
  Fly   186 I--------QAIFEYITMSF---AVLQDQLSD--------TYPLMFTIMFRAHMEVLKDHVRSLR 231

  Fly   258 HDLEFLQA--------TVAYHQSLIHLCQD---------------INEIFGVSLLSNFVSSSFII 299
            .|.|..:|        .|..|::::..|..               |..:.|::|::.|..|:|  
  Fly   232 MDPERSEADNYQDLVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNF-- 294

  Fly   300 CFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRK 364
             :.|            |..:||:...::|.|........|:|.::.:...::..:|..|:.||:.
  Fly   295 -WKG------------VASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKA 346

  Fly   365 MLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409
            .|:|.:...|||....|.....||:.:...:.:.::....::|.|
  Fly   347 TLVLFMHHVQQPIIFIAGGIFPISMNSNITVAKFAFSIITIVRQM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 67/342 (20%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 76/381 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.