DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or49b

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster


Alignment Length:393 Identity:86/393 - (21%)
Similarity:157/393 - (39%) Gaps:88/393 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YANVFYLSIGMMAY----DH-KY---SQKWKEVLLHWTFIAQMVNLNTVLISELIYVFLAIGKGS 83
            |..|.:::..:.||    || :|   .||..|...      .::|||...|||::.....:||  
  Fly    61 YMLVLWINTVLRAYLLLADHDRYLALIQKLTEAYY------DLLNLNDSYISEILDQVNKVGK-- 117

  Fly    84 NFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEPYNIGHHLSGYSRY 148
              |.|..|| |.|.:....|.::.:|...:.|                   |:  |..:.|.:.|
  Fly   118 --LMARGNL-FFGMLTSMGFGLYPLSSSERVL-------------------PF--GSKIPGLNEY 158

  Fly   149 SKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIG 213
            ...|:.|           |.::.::            :.|..|.:          |..|.|..:|
  Fly   159 ESPYYEM-----------WYIFQML------------ITPMGCCM----------YIPYTSLIVG 190

  Fly   214 GQACLSGQLAADMLMCALVTL-VVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLC 277
                        ::|..:|.. .:.|.:|..|  ..|..|....:...|.:.|.:.|.||:|...
  Fly   191 ------------LIMFGIVRCKALQHRLRQVA--LKHPYGDRDPRELREEIIACIRYQQSIIEYM 241

  Fly   278 QDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDA 342
            ..|||:..:..|...::.|.::|.:.|.:.|.|....|:::.:::...:.|:..:..:|..|.:.
  Fly   242 DHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQ 306

  Fly   343 SEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLR 407
            :..:..|.|..:||..|:..||.::.::.|||:|:.:.......|:|....:||..:|.||.:|:
  Fly   307 NLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLK 371

  Fly   408 TMY 410
            .:|
  Fly   372 RVY 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 63/316 (20%)
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 81/381 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.