DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or45b

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:158/446 - (35%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLHSFLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIYVFLAIGKGSN 84
            ||...|.:...:  |.|::.......|.|..:|  | .:...|||.....:|.::       |.:
  Fly    11 PLAKHLFFVTRY--SFGLLGLRFGKEQSWLHLL--W-LVFNFVNLAHCCQAEFVF-------GWS 63

  Fly    85 FLEAT----------MNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEP---- 135
            .|..:          :..||...     ||:..:..:|:.:..::.|:..|    :.:||.    
  Fly    64 HLRTSPVDAMDAFCPLACSFTTL-----FKLGWMWWRRQEVADLMDRIRLL----IGEQEKREDS 119

  Fly   136 --------------------YNIGHHLSG-----------YSRYSKFYFGMHMVLI---WTYNLY 166
                                :.:|...:|           ..|:.:|.|.|...::   :.:.:.
  Fly   120 RRKVAQRSYYLMVTRCGMLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMP 184

  Fly   167 WAVYYLVCDFWLGMRQFERMLPYYCWVPWD-WSTGYSYYFMYISQNIGGQACLSGQLAADMLMCA 230
            |...:.:...|.|      .:..|.:...| :..|::.|..::.|          .|..| :..|
  Fly   185 WFPVFYLYSTWSG------QVTVYAFAGTDGFFFGFTLYMAFLLQ----------ALRYD-IQDA 232

  Fly   231 LVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSS 295
            |..      ||..:..||.:.        .:.|...|..|..:..:.::.:.|.......:|||:
  Fly   233 LKP------IRDPSLRESKIC--------CQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSA 283

  Fly   296 SFIICFVGFQMTIGSKID-------NLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNH 353
            |.:|.        .|.||       |::..|::.|.....:|:.......:...|..:|:|.|:.
  Fly   284 SLVIA--------TSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSS 340

  Fly   354 DWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409
            .|:..|...|:.:.|||.|||:|..::...|.. ||...:.:::.:....||.:|:
  Fly   341 AWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 65/371 (18%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 64/366 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.