DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or45a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:367 Identity:80/367 - (21%)
Similarity:149/367 - (40%) Gaps:51/367 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VLISELI-----YVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELH 126
            :||..||     .|..|:...|:....|.|.:.........||...:..:|:|:..::.||.:|:
  Fly    35 ILILSLISHNWPMVVYALQDLSDLTRLTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLN 99

  Fly   127 ------PQGLAQQEPYNIGHHLSGY--SRYSKFYFGM-------HMVL-IWTY---NLYWAVYYL 172
                  |..|.:.|..|   .|..|  ..:....:|:       .|:| :|.|   .::.....:
  Fly   100 QAASATPNHLEKIEREN---QLDRYVARSFRNAAYGVICASAIAPMLLGLWGYVETGVFTPTTPM 161

  Fly   173 VCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVM 237
            ..:|||..|:     |::.|..:.|..            :|..|.....:|.|.|...|...||:
  Fly   162 EFNFWLDERK-----PHFYWPIYVWGV------------LGVAAAAWLAIATDTLFSWLTHNVVI 209

  Fly   238 HFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFV 302
            .|..|...:|......|..:     |...|:.|:..:.|.::::.|||..:...::.|...:|.:
  Fly   210 QFQLLELVLEEKDLNGGDSR-----LTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCML 269

  Fly   303 GFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNH-DWFRADLRYRKML 366
            .|:.:.......:.....||...::|:.......:.:...|..|.||||.. :|.....:.|::.
  Fly   270 AFRFSRSGWSAQVPFRATFLVAIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLW 334

  Fly   367 ILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRT 408
            .::|.|||:|:::...||: :.|..:..:::.:..|.|:|||
  Fly   335 QMVIMRAQRPAKIFGFMFV-VDLPLLLWVIRTAGSFLAMLRT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 68/335 (20%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 67/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465710
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.