DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or33b

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523554.1 Gene:Or33b / 34602 FlyBaseID:FBgn0026391 Length:379 Species:Drosophila melanogaster


Alignment Length:412 Identity:72/412 - (17%)
Similarity:151/412 - (36%) Gaps:93/412 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YSQKWKEVLLHW--------TFIAQMVNLNTVLISELIY-VFLAIGKGSNFLEATM-----NLSF 94
            |...|    |:|        .|:.::::|...:...:.| :.|.:|.   |:|.::     .|..
  Fly    14 YRTYW----LYWHLLGLESNFFLNRLLDLVITIFVTIWYPIHLILGL---FMERSLGDVCKGLPI 71

  Fly    95 IGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQE-----------------PYNIGHHL 142
            ........||......:...:.::....:||..:.|:::|                 .:.:.:.|
  Fly    72 TAACFFASFKFICFRFKLSEIKEIEILFKELDQRALSREECEFFNQNTRREANFIWKSFIVAYGL 136

  Fly   143 SGYSRYSKFYF-GMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFM 206
            |..|..:...| |.|.:|                             |..|.|:|.......:::
  Fly   137 SNISAIASVLFGGGHKLL-----------------------------YPAWFPYDVQATELIFWL 172

  Fly   207 YISQNIGG-QACLSGQLAAD----MLMCAL---VTLVVMHFIRLSAHIESHVAGIGSFQHDLEFL 263
            .::..|.| ...:...||.|    |..|.:   |.|:.|...|:....|..:...|      :.|
  Fly   173 SVTYQIAGVSLAILQNLANDSYPPMTFCVVAGHVRLLAMRLSRIGQGPEETIYLTG------KQL 231

  Fly   264 QATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKI---DNLVMLVLF--LF 323
            ..::..|:.|:.:.:.:.....:|.|..|:||.     |...:|:.:.:   ||...:..:  .|
  Fly   232 IESIEDHRKLMKIVELLRSTMNISQLGQFISSG-----VNISITLVNILFFADNNFAITYYGVYF 291

  Fly   324 CAMV-QVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNI 387
            .:|| ::|....:...:.....|:..|:|:.:|...:..|.::|::.::......::||...:.|
  Fly   292 LSMVLELFPCCYYGTLISVEMNQLTYAIYSSNWMSMNRSYSRILLIFMQLTLAEVQIKAGGMIGI 356

  Fly   388 SLVTVSDLLQLSYKFFALLRTM 409
            .:......::|:|.||.|..::
  Fly   357 GMNAFFATVRLAYSFFTLAMSL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 59/352 (17%)
Or33bNP_523554.1 7tm_6 61..369 CDD:251636 57/347 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.