DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or23a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:408 Identity:80/408 - (19%)
Similarity:152/408 - (37%) Gaps:100/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AYDHKYSQKWKEVLLHWT-FIAQMVNLNTVLISELIYVF-----------LAIGKGSNFLEATMN 91
            |.|....:.|.     |: .:..:|.|.|.::...:|.|           |.:...||.::..|.
  Fly    24 ALDLSEGRYWS-----WSMLLCILVYLPTPMLLRGVYSFEDPVENNFSLSLTVTSLSNLMKFCMY 83

  Fly    92 LSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQ--GLAQQEPY-NIGHHLSGYSRYSKFYF 153
            ::                 |..::.:|.|.:.:|..:  |.:|.|.: |:..||   .|.||.  
  Fly    84 VA-----------------QLTKMVEVQSLIGQLDARVSGESQSERHRNMTEHL---LRMSKL-- 126

  Fly   154 GMHMVLIWTYNLYWAVYYLVC--DFWLGMRQFERMLPYYCWVPWDWSTG-YSYYFMYISQNIGGQ 215
                     :.:.:||.:::.  .|   :.:.|..||...|.|:||... .:|....:.|.||..
  Fly   127 ---------FQITYAVVFIIAAVPF---VFETELSLPMPMWFPFDWKNSMVAYIGALVFQEIGYV 179

  Fly   216 ACLSGQLAADML----------MCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYH 270
            ..:....|||..          .|.|:.|              .::.||.....||      ...
  Fly   180 FQIMQCFAADSFPPLVLYLISEQCQLLIL--------------RISEIGYGYKTLE------ENE 224

  Fly   271 QSLIHLCQDINEIFGV-----SLLSNFVSSSFIICFVGFQMT-------IGSKIDNLVMLVLFLF 323
            |.|::..:|.|.::.:     ||:|..:...|::..:...:|       :.:..|.:..| .||.
  Fly   225 QDLVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYL-CFLL 288

  Fly   324 CAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNIS 388
            ...||.:.:..:...:.::..::..||:..:|......||..::::.:|.::...|.|...:.|.
  Fly   289 GITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIH 353

  Fly   389 LVTVSDLLQLSYKFFALL 406
            |.|.....:.:|.||.|:
  Fly   354 LSTYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 65/343 (19%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 67/360 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.