DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or10a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:436 Identity:91/436 - (20%)
Similarity:179/436 - (41%) Gaps:89/436 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FLK---YANVFY-----LSIGMMAY-DHKYSQKWK-EVLLHWTFIAQMVNLNTVLISELIYVFLA 78
            |||   ..:|::     ||:.:|.| ..|....|. ..|:|:..:|             |.|...
  Fly     7 FLKRDQQLDVYFFAVPRLSLDIMGYWPGKTGDTWPWRSLIHFAILA-------------IGVATE 58

  Fly    79 IGKGSNFLE------ATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGL------- 130
            :..|..||:      |...|...|...|...|::.:.|.|:.|:.:.:||     :||       
  Fly    59 LHAGMCFLDRQQITLALETLCPAGTSAVTLLKMFLMLRFRQDLSIMWNRL-----RGLLFDPNWE 118

  Fly   131 -AQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVC-------DF-W---LGMRQF 183
             .:|....:.|.... :|.:.:..........||||...:..::.       || |   ..|...
  Fly   119 RPEQRDIRLKHSAMA-ARINFWPLSAGFFTCTTYNLKPILIAMILYLQNRYEDFVWFTPFNMTMP 182

  Fly   184 ERMLPY------YCWVPWDWSTGYSYYFMYISQNIGG------QACLSGQLAADMLMCALVTLVV 236
            :.:|.|      |.::.:   |||...||:     ||      :.|.......::|...:.::  
  Fly   183 KVLLNYPFFPLTYIFIAY---TGYVTIFMF-----GGCDGFYFEFCAHLSALFEVLQAEIESM-- 237

  Fly   237 MHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICF 301
              |...:.|:|.....:...:   :.:::.:..|.::|.|.:...:.:.:..|::|||::.:|  
  Fly   238 --FRPYTDHLELSPVQLYILE---QKMRSVIIRHNAIIDLTRFFRDRYTIITLAHFVSAAMVI-- 295

  Fly   302 VGFQM----TIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRY 362
             ||.|    |:|:.....::.|.:...|:.|:.:.......:.::|..:.:|:::..|.....:.
  Fly   296 -GFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQ 359

  Fly   363 RKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRT 408
            |:::.|:|.|:|:|..: |..|.:.||.|.:.:||.|....||:::
  Fly   360 RRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 72/356 (20%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 70/350 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.