DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or82a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:379 Identity:82/379 - (21%)
Similarity:157/379 - (41%) Gaps:66/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ISELIYVFLA-------IGKGSNFLE---ATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLE 123
            ||.||:|..|       :....|.:|   |.:::.|...:.|  .||......||...:::.|..
  Fly    34 ISSLIFVISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTV--IKISTFLANRKDFWEMIHRFR 96

  Fly   124 ELHPQGLAQQEPYNIG-HHLSGYSRYSKFYFGMHMVLIWTYNLYW----AVYYLVCDFWLGMRQF 183
            ::|.|..:....|..| .:::..::.:.|....:.|......||:    .|...||. |.| ...
  Fly    97 KMHEQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCR-WHG-TTC 159

  Fly   184 ERMLPYYCWVPWD--WSTGYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMH-------- 238
            ::.||.....|::  .|.||...|:|                     ..|||:||:.        
  Fly   160 DKELPMPMKFPFNDLESPGYEVCFLY---------------------TVLVTVVVVAYASAVDGL 203

  Fly   239 FIRLSAHIESHVAGIGSFQHDLEF----------LQATVAYHQSLIHLCQDINEIFGVSLLSNFV 293
            ||..:.::.:|...:.....:.||          |::.|.||..|:.|.:.:..|:..:::..||
  Fly   204 FISFAINLRAHFQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFV 268

  Fly   294 SSSFIICFVGFQMTIGSKIDNLVMLVL---FLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDW 355
            .:|..:..:.:|:.  :.:|:::.|:|   |....|:|:|:.....:.:...|.|:..||...:|
  Fly   269 ITSLQVGVIIYQLV--TNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNW 331

  Fly   356 FRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409
            ..|..:.|..|.|||.::|:...::|..|: .||.....:.:.:.....|::::
  Fly   332 HLASPKTRTSLSLIILQSQKEVLIRAGFFV-ASLANFVGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 75/346 (22%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 72/336 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.