DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or2a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:408 Identity:88/408 - (21%)
Similarity:153/408 - (37%) Gaps:81/408 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VLLHW-----------------TFIAQMVNLNTV--------LISELIYVFLAIGKGSNFLEATM 90
            |..||                 .::...:.:|.|        |::.|::.       :|......
  Fly    15 VYYHWRVWELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFT-------TNMAGLCE 72

  Fly    91 NLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEPYNIG------HHLSGYSR-- 147
            ||:.....||.:.|..|:...||:|.::.|.|..:..:.....:|..|.      :...|..|  
  Fly    73 NLTITITDIVANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTF 137

  Fly   148 YSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDW--STGYSYYFMYISQ 210
            .|.|.||..:..:..                 :.:.:|.|.|..|...||  || .:|..:.|.|
  Fly   138 ASIFVFGTTLSCVRV-----------------VVRPDRELLYPAWFGVDWMHST-RNYVLINIYQ 184

  Fly   211 NIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAY----HQ 271
            ..|.........|:|....|.:.|:..|...|    |..|..||.........|...|:    :|
  Fly   185 LFGLIVQAIQNCASDSYPPAFLCLLTGHMRAL----ELRVRRIGCRTEKSNKGQTYEAWREEVYQ 245

  Fly   272 SLIHLCQD----------INEIFGVSLLSNFVSSSFIICFVGFQ-MTIGSKIDNLVMLVLFLFCA 325
            .||...:|          |..:..|..::.||.|:.:.|.|... :.:....|:..|::..:|.:
  Fly   246 ELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFS 310

  Fly   326 MV--QVFMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNIS 388
            .|  :||:|.....|:...||.:..|.|:.:|.....::::.|:..:.|.|:||.:.|..::.:|
  Fly   311 AVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALS 375

  Fly   389 LVTVSDLLQLSYKFFALL 406
            |.|...:::.:|..|.||
  Fly   376 LETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 77/342 (23%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 77/342 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.