DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85d and Or69a

DIOPT Version :9

Sequence 1:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:394 Identity:82/394 - (20%)
Similarity:164/394 - (41%) Gaps:52/394 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIYVFLAIGKGSNFLEA 88
            :|...|:.|.:||.:.|.:....:.|:.:   .::|::.::                        
  Fly    43 WLGAVNLVYHNIGCVMYGYFGDGRTKDPI---AYLAELASV------------------------ 80

  Fly    89 TMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEPYNIGHHLSGYSRYSKFYF 153
               .|.:||.|||...:|.:...:.....:::..|||..  |.:...|.|.|:...|:|:.:..|
  Fly    81 ---ASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELFQ--LIKHRAYRIHHYQEKYTRHIRNTF 140

  Fly   154 GMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWSTGYSYYFMYISQNIGGQACL 218
            ..|...:..||.. .:..::.:.:...:|....:....|.||........:|..:       ||.
  Fly   141 IFHTSAVVYYNSL-PILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAV-------ACQ 197

  Fly   219 SGQLAADMLMCALVTLVVMHF-IRLSAHIESHVAGIGSFQ----HDLEFLQATVAYHQSLIHLCQ 278
            ......:|.:...:..::..| |:|..|.:.....:.:..    |..:.|:..:.||..|::|..
  Fly   198 IFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLETIDARNPHAKDQLKYLIVYHTKLLNLAD 262

  Fly   279 DINEIFGVSLLSNFVSSSFIICFVGFQMTI---GSKIDNLVMLVLFLFCAMVQVFMIATHAQRLV 340
            .:|..|..:.|.:...|....||:.|.||:   |:.:.:|:.|:||:    ...|.:......|:
  Fly   263 RVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFI----TYNFSMCRSGTHLI 323

  Fly   341 DASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFAL 405
            ..|.::..|.:.::|:..||.||:||::::.||.:|...|......:|:.|....|:.||:.|..
  Fly   324 LTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMATLKFSYQMFTC 388

  Fly   406 LRTM 409
            :|::
  Fly   389 VRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 70/323 (22%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 71/349 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.