DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11737 and AT5G51150

DIOPT Version :9

Sequence 1:NP_001262370.1 Gene:CG11737 / 41009 FlyBaseID:FBgn0037592 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_199928.1 Gene:AT5G51150 / 835189 AraportID:AT5G51150 Length:531 Species:Arabidopsis thaliana


Alignment Length:290 Identity:59/290 - (20%)
Similarity:116/290 - (40%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KEEAGPIVKSGPAVPGEQ----------PAPDRRRPTVSFSTVSDWVRVYSNLIRAKH-ESCRHQ 245
            |.:..|.....|..|..|          .|.:|.|     ..:::..|...:..|..| |.|.|.
plant     7 KPDLDPSSSPPPISPLSQDSSEAERRLREAEERLR-----DAMAELQRRQRSAARGSHAELCDHA 66

  Fly   246 Q-SCIGYSLMGGIKPFVGGVGLQVALKLVMNVKRITAGK-----------MPWKKMIFNRGTLQL 298
            . ||:..::....:.|:...|::|.:.:::...::..|:           :..|.:|......::
plant    67 DVSCVANAIGNLCQSFLLSYGVRVGIGILLRAFKLARGQSYSSLLDLKQLVSEKDLIVREEACRI 131

  Fly   299 GIFMGSFSFLYKSVSCLLRHSFNRDDARFAIPASLIASISFTQYPDN----TVALYVMWK----A 355
            |:..|.|:..|.::.|.||....::....::.|..:|.:|.....|:    |:|||::.:    |
plant   132 GLLFGGFTGSYHALRCCLRKWRKKETPLNSVLAGSVAGLSILALDDSNQRRTLALYLLARLGQAA 196

  Fly   356 LQILCTKGQEHGIVPHIPNFMLFLYSFFTAVLFHAGILEPKSLRPSYYKFLQ------------- 407
            .....:|.:.|....|..:....|:|...|.:.::.|:.|::|..||.:|:|             
plant   197 YNSAKSKNKFHLWGSHWRHGDSLLFSLACAQVMYSFIMRPETLPKSYREFIQKTGPVARPVYQAV 261

  Fly   408 --AISGDRLSKFNLSAFDVFGLSSQQQALD 435
              ...|..:...:|||:    :||:.:|.|
plant   262 RECCRGGPIDVASLSAY----ISSKNEASD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11737NP_001262370.1 TMEM135_C_rich 14..145 CDD:292604
AT5G51150NP_199928.1 Tim17 <124..>175 CDD:280604 10/50 (20%)
TMEM135_C_rich <360..431 CDD:292604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1398
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D706534at2759
OrthoFinder 1 1.000 - - FOG0004145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.