DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85c and LOC1279017

DIOPT Version :10

Sequence 1:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_318674.2 Gene:LOC1279017 / 1279017 VectorBaseID:AGAMI1_009520 Length:115 Species:Anopheles gambiae


Alignment Length:91 Identity:21/91 - (23%)
Similarity:46/91 - (50%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 FLFSSLSQVYLICHYGQLIADASSSLSISAYKQNWQNADIRYRRALVFFIARPQRTTYLKATIFM 362
            :|....|||::.|:.|..|:..:...:......|:...|.|..:|::||:....:..::|....:
Mosquito    22 YLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFKFDKRTSQAMIFFLQMTLKDVHIKVGSVL 86

  Fly   363 NIT--RATMTDLLQVSYKFFALLRTM 386
            .:|  ..|...::::||.:.|:|::|
Mosquito    87 KVTLNLHTFLQIMKLSYSYLAVLQSM 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 16/80 (20%)
LOC1279017XP_318674.2 None

Return to query results.
Submit another query.