DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or98b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:412 Identity:87/412 - (21%)
Similarity:157/412 - (38%) Gaps:96/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LMKYASF--FYTAVGIRPYTNGE---ESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNK 63
            ::..|||  ...|.|::...|.|   :|..:.|:       :::.|..:|||  :::|..|   |
  Fly    39 ILSVASFMPLTIAFGLQNVQNVEQLTDSLCSVLV-------DLLALCKIGLF--LWLYKDF---K 91

  Fly    64 FLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRIS 128
            ||             :|...........||:.|:|          :.||            ||..
  Fly    92 FL-------------IGQFYCVLQTETHTAVAEMI----------VTRE------------SRRD 121

  Fly   129 LIYSLLYSVLIWTFNL-FCVMEYWVYDKWLNIRVVGK---QLPYLMYIPWKWQDNW--SYYPLLF 187
            ...|.:|:....|..| .|:|.  .....::.:..|:   :.|:....||   ||.  |.|.:.:
  Fly   122 QFISAMYAYCFITAGLSACLMS--PLSMLISYQRTGELQPKFPFPSVYPW---DNMKLSNYIISY 181

  Fly   188 SQNF-AGYTSAAGQISTDVLLCA----------VATQLVMHFDFLSNSMERHELSGDWKKDSRFL 241
            ..|. |....|...:..|.|.|:          :|...:|||:. .|:.|.||          .|
  Fly   182 FWNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFEG-RNTKETHE----------NL 235

  Fly   242 VDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQ 306
            ..:.:.:...|.|...:|:.|. ||:..|:.:|..:|.:.:|::..:....::....|..:.:.|
  Fly   236 KHVFQLYALCLNLGHFLNEYFR-PLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAAVVGQ 299

  Fly   307 VYLICHYGQLVADASYGFSVATYNQKW---YKADVRYKRALVIIIARSQKVTFLKATI---FLDI 365
            |.:.|..|..:......|..|.|...|   .:.:::...:|.|.:.||.    |...|   |.:.
  Fly   300 VSIYCFCGSSIHSECQLFGQAIYESSWPHLLQENLQLVSSLKIAMMRSS----LGCPIDGYFFEA 360

  Fly   366 TRSTMTDLLQISYKFFALLRTM 387
            .|.|:..:::.:..:..|||::
  Fly   361 NRETLITIVRTAISYVTLLRSL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 68/336 (20%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 79/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.