DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or98a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:366 Identity:69/366 - (18%)
Similarity:130/366 - (35%) Gaps:109/366 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTA 93
            |:|:..:..:.|.:.:.|..||.::|:...:...|.|                |:|     .|..
  Fly    76 NELLTVMQLFFNSVGMPFKVLFFNLYISGFYKAKKLL----------------SEM-----DKRC 119

  Fly    94 ITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLN 158
            .|  :.|..|:: .|::|            |::..|||..:|:.  :|.:.|           |:
  Fly   120 TT--LKERVEVH-QGVVR------------CNKAYLIYQFIYTA--YTISTF-----------LS 156

  Fly   159 IRVVGKQLPYLMYIPWKWQDNWSYYPLL-FSQNFAGYTSAAGQISTDVLLCAVATQLVM------ 216
            ..:.||       :||:     .|.|.: |.::.:.:..||  ::...|:....||.:|      
  Fly   157 AALSGK-------LPWR-----IYNPFVDFRESRSSFWKAA--LNETALMLFAVTQTLMSDIYPL 207

  Fly   217 --------HFDFLSNSMERHELSGDWKK----DSRFLVDIVRYHERILRLSDAVNDIFGIPLLLN 269
                    |...|...:|  .|..|..|    :.:.|:..::.|..|:..:.|:.......:.:.
  Fly   208 LYGLILRVHLKLLRLRVE--SLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIRPAVTRTIFVQ 270

  Fly   270 FMVSSFVICFVGFQMTVGVPPDIVVKLFLF------------LVSSMSQVYLICHYGQLVADASY 322
            |::..  || :|..|         :.|..|            :...|.|.:..|....|:.....
  Fly   271 FLLIG--IC-LGLSM---------INLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLLKKDCE 323

  Fly   323 GFSVATYNQKWYKADVRYKRALVIIIARSQK-VTFLKATIF 362
            ....|.::..|..:...||.:|...:..:|| :.|...:||
  Fly   324 LLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 61/331 (18%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 69/366 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.