DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or94b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:406 Identity:86/406 - (21%)
Similarity:161/406 - (39%) Gaps:83/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VGIRPYTN-GEESKMN--KLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGF 76
            :|:..:.| ||:..:.  |.|:..     |::|.....:.::..|.|...:.|.||...| |:..
  Fly    20 IGLLKWENEGEDGVLTWLKRIYPF-----VLHLPLTFTYIALMWYEAITSSDFEEAGQVL-YMSI 78

  Fly    77 VTVGM-SKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIW 140
            ..:.: :|:..|.:::.....||:||:        .:..:||        |.|      ..:..|
  Fly    79 TELALVTKLLNIWYRRHEAASLIHELQ--------HDPAFNL--------RNS------EEIKFW 121

  Fly   141 TFNL--FCVMEYWVYDKWLNIRVVG---------KQLPYLMYIPWKWQDNWSYYPLLFSQNFA-G 193
            ..|.  |..:.||.....|.:.|:|         .:||:..|:|::|:....|:       :| |
  Fly   122 QQNQRNFKRIFYWYIWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYF-------YAWG 179

  Fly   194 YTSAA------GQISTDVLLC-------AVATQLVMHFDFLSNSMERHELSGDWKKDSRFLVDIV 245
            |...|      ..|..|.|.|       ::...|.|..:.|.|:.|        :|....|..|.
  Fly   180 YNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAE--------EKARPELRRIF 236

  Fly   246 RYHERILRLSDAVNDIFGIPLLLNFMVSSFVICF-------VGFQMTVGVPPDIVVKLFLFLVSS 303
            :.|.::.||:.....:....:|...:.|:|:|||       :||:..    |.:.|....|:...
  Fly   237 QLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQR----PGLFVTTVQFVAVM 297

  Fly   304 MSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRS 368
            :.|::|.|:||..:...:...:.:.:...|.:..|..::.|...:...::...::|.:|.:|...
  Fly   298 IVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLP 362

  Fly   369 TMTDLLQISYKFFALL 384
            .....:..:|.|||||
  Fly   363 IFVKTINNAYSFFALL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 70/346 (20%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 70/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.