DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or94a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:419 Identity:88/419 - (21%)
Similarity:163/419 - (38%) Gaps:82/419 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLMKYASFFYTAVGIRPYT-NGEES-------KMN-KLIFHIVFWSNVINLSFVGLFESIYVY 56
            |..:::....|    |:.|:: ..||.       |.| :.:.|:     .|..:|:||.    ..
  Fly    11 MRLILQVMQLF----GLWPWSLKSEEEWTFTGFVKRNYRFLLHL-----PITFTFIGLM----WL 62

  Fly    57 SAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWK-KTAITELINELKEIYPNGLI---------- 110
            .||:.:. ||....:.|:....:.:.......|. :|....|:.||:.. |:..:          
  Fly    63 EAFISSN-LEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYELQHA-PDYQLHNQEEVDFWR 125

  Fly   111 REER-YNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPW 174
            ||:| :....|:.....:.::||....||.                     :.|.:||:..|:|:
  Fly   126 REQRFFKWFFYIYILISLGVVYSGCTGVLF---------------------LEGYELPFAYYVPF 169

  Fly   175 KWQDNWSYYPLLFSQNFAGYT-SAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSG------ 232
            :||:...|: ..:..:.||.| :....|:.|.|.|    ..:.|...|      :.|.|      
  Fly   170 EWQNERRYW-FAYGYDMAGMTLTCISNITLDTLGC----YFLFHISLL------YRLLGLRLRET 223

  Fly   233 -DWKKDSRF---LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMT-VGV--PP 290
             :.|.|:.|   |..|...|:||..|:.....|....:|...::|:.:|||.|:::. ||:  .|
  Fly   224 KNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQIILSALIICFSGYRLQHVGIRDNP 288

  Fly   291 DIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVT 355
            ...:.:..|:...:.|:||.|:||..:...:...:...|:..|.:.....::.|...:...:|..
  Fly   289 GQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPV 353

  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALL 384
            .::|..|..:........:..:|.|.|||
  Fly   354 TIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 68/339 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 68/340 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.