DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or85f

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:372 Identity:96/372 - (25%)
Similarity:167/372 - (44%) Gaps:53/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAIT 95
            ::|.:|....:.|:|.:..:.::..|....|.||   .|.|                  :::||.
  Fly    57 MVFRMVEAKTIDNVSLIMRYATLVTYIINSDTKF---ATVL------------------QRSAIQ 100

  Fly    96 ELINELKEIYPNGLI-------------REERYNLPMYLGTCSRISLIYSLLYSVLIW-TFNLFC 146
            .|.::|.|:||...:             :...|.:.:|:|: |.:.:|..::.|::.: |.|:|.
  Fly   101 SLNSKLAELYPKTTLDRIYHRVNDHYWTKSFVYLVIIYIGS-SIMVVIGPIITSIIAYFTHNVFT 164

  Fly   147 VMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVA 211
            .|..:               ||.:|.|.| ...|.|..:...:...........|..|:.|....
  Fly   165 YMHCY---------------PYFLYDPEK-DPVWIYISIYALEWLHSTQMVISNIGADIWLLYFQ 213

  Fly   212 TQLVMHFDFLSNSMERHELSGDW-KKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSF 275
            .|:.:||..:..|:..|:.|... ::|.:|:..||.....::.|.:.:|.|||..|||:.:.::.
  Fly   214 VQINLHFRGIIRSLADHKPSVKHDQEDRKFIAKIVDKQVHLVSLQNDLNGIFGKSLLLSLLTTAA 278

  Fly   276 VICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRY 340
            |||.|.....:..|........:|:.:|:.||||:|:|||.|.|.|...:.|.||..::.|.:.|
  Fly   279 VICTVAVYTLIQGPTLEGFTYVIFIGTSVMQVYLVCYYGQQVLDLSGEVAHAVYNHDFHDASIAY 343

  Fly   341 KRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            ||.|:|||.|:|:...|.|..:|.|:..|...|:.:||:...:|..|
  Fly   344 KRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 85/328 (26%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 90/350 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.