DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or85a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:287 Identity:52/287 - (18%)
Similarity:112/287 - (39%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIR-----VVGKQLPYLMY 171
            ||:..:......|:|:.:||                  :.:|..:|::.     |:|| .|:.:|
  Fly   126 EEKVQVHRAAALCNRVVVIY------------------HCIYFGYLSMALTGALVIGK-TPFCLY 171

  Fly   172 IPWKWQDNWSYY-PLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWK 235
            .|....|:..|. ..:.|...||...|  .:..||........|.:|.:.||..::......:..
  Fly   172 NPLVNPDDHFYLATAIESVTMAGIILA--NLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKG 234

  Fly   236 KDSRF--LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFV--ICFVGFQMTVGVPPDIVVKL 296
            .|..:  ||:.|:.|:.|:...:.:..:....:.:..:....:  :..|..|....|...:|.. 
  Fly   235 DDQHYAELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVVSG- 298

  Fly   297 FLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIAR-SQKVTFLKAT 360
             ::.::.:||.:..|:..:.::......:...::.||..|:.||:..::..|.. .|.:.|....
  Fly   299 -VYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGG 362

  Fly   361 IFLDITRSTMTDLLQISYKFFALLRTM 387
            || .|..:|...:.:.::....::..|
  Fly   363 IF-PICLNTNIKMAKFAFSVVTIVNEM 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 51/276 (18%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 51/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.