DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or83a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:409 Identity:72/409 - (17%)
Similarity:150/409 - (36%) Gaps:85/409 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 INLSFVGLFE-SIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIY 105
            :::...||:. :||:.....|..|.......:.|...|:.| |::|.|::...:..:::.:.:.|
  Fly    63 VSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLWTIAM-KLYFRRFRPGLLNTILSNINDEY 126

  Fly   106 PNGLIREERYNLPMYLGTCS---RISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVV--GKQ 165
                  |.|..:.....|.:   |:|.::...|....:...:|          ||.:.:.  .:.
  Fly   127 ------ETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIF----------WLALPIAYRDRS 175

  Fly   166 LPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQIST----------------DVLLCAVATQL 214
            ||...:.|:.:... ..|.::|.....|....|...::                |||.|::...|
  Fly   176 LPLACWYPFDYTQP-GVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVL 239

  Fly   215 VMHFDFL-SNSMERHELSGDWKK------------------------------DSRFLVDIVR-- 246
            ...:..: :|..|.::|..:...                              .|.|.:..||  
  Fly   240 ASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCI 304

  Fly   247 -YHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDI---VVKLFLFLVSSMSQV 307
             :|..|:.....:...:.....:.....:|::|.|.|..|.....:.   :|.|..:|:..:.::
  Fly   305 QHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQYLLLVLYEL 369

  Fly   308 YLICHYGQLVADASYGFSVATYNQKWYK--ADVRYKRALVIIIARSQ-KVTFLK-ATIFLDITRS 368
            ::||::..:|...|.....|.:...|.:  .|||......::.:|.| ::|..| :.:.:|..|.
  Fly   370 FIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRFRG 434

  Fly   369 TMTDLLQISYKFFALLRTM 387
            |:|    .::.|..||:.|
  Fly   435 TIT----TAFSFLTLLQKM 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 63/375 (17%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 49/299 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.