DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or74a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:365 Identity:71/365 - (19%)
Similarity:141/365 - (38%) Gaps:74/365 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MDNKFLEAVTALSYIGFVTVGMS-KMFFIRWKKTAITELINEL-KEIYPNGLIREERYNLPMYLG 122
            |||......|.|     :.|.|. :.|.:.|.|.....|:... .|||    :.||..  |....
  Fly    76 MDNMLTGLPTYL-----ILVEMQIRCFQLAWHKDRFRALLQRFYAEIY----VSEEME--PHLFA 129

  Fly   123 TCSRISL---IYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWS--- 181
            :..|..|   :.|.:|.:.:..|.|..|... :|.:        :::.|....|:   ||..   
  Fly   130 SIQRQMLATRVNSTVYLLALLNFFLVPVTNV-IYHR--------REMLYKQVYPF---DNTQLHF 182

  Fly   182 YYPLLFSQNFAGYTSAAGQISTDVLL--CAVATQLVMHFDFLSNSMERH-ELSGDWKKDSRFLVD 243
            :.|||....:.|:      |.|.:|.  ..|..:|:||.:      .|: :|..|.::.::.|:.
  Fly   183 FIPLLVLNFWVGF------IITSMLFGELNVMGELMMHLN------ARYIQLGQDLRRSAQMLLK 235

  Fly   244 -------IVRYH---ERILRLSDAVNDI-------FGIPLLLNFMVSSFVICFVGFQMTVGVPPD 291
                   .:.|.   ..|||.:.|:.|.       |.:.:.:.|..|:.::|.:.|:.... |..
  Fly   236 KSSSLNVAIAYRLNLTHILRRNAALRDFGQRVEKEFTLRIFVMFAFSAGLLCALFFKAFTN-PWG 299

  Fly   292 IVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKW----YKAD-----VRYKRALVII 347
            .|..:..||...| ::..:...|.::...:....:..|...|    :::|     |:..:.:.:.
  Fly   300 NVAYIVWFLAKFM-ELLALGMLGSILLKTTDELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLA 363

  Fly   348 IARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            |..:.:..|:....:..::.:.:..::|.::.:|..|.:|
  Fly   364 IQLNSRPFFITGLNYFRVSLTAVLKIIQGAFSYFTFLNSM 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 65/350 (19%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 68/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472819
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.