DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or67d

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:378 Identity:79/378 - (20%)
Similarity:160/378 - (42%) Gaps:58/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFWSNVINLSFVGLF-----ESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAIT 95
            ::|.....::.:..|     .:||| ...::......:.||:.:|....|::|:.......:.:.
  Fly    38 MWWLTYAVMAAIAFFFACTGYTIYV-GVVINGDLTIILQALAMVGSAVQGLTKLLVTANNASHMR 101

  Fly    96 ELINELKEI----------YPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEY 150
            |:.|..::|          |...|.:..|....:.:|    ..|:|.:|..::| ||.:|.::  
  Fly   102 EVQNTYEDIYREYGSKGDEYAKCLEKRIRITWTLLIG----FMLVYIILLGLVI-TFPIFYLL-- 159

  Fly   151 WVYDKWLNIRVVGKQLPYLMYIPWKWQDN-----WSYYPLLFSQNFAGYTSAAGQISTDVLLCAV 210
            .::.|.|.::.:   :|:|.:.    .|.     .:.:.:|.:  |.|:    |....|:.|...
  Fly   160 ILHQKVLVMQFL---IPFLDHT----TDGGHLILTAAHVILIT--FGGF----GNYGGDMYLFLF 211

  Fly   211 ATQLVMHFD-FLSNSMERHEL---SGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFM 271
            .|.:.:..| |.....|.:||   ..|:.|....|.|::.:|:...|:......|:.|.|.:...
  Fly   212 VTHVPLIKDIFCVKLTEFNELVMKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQLS 276

  Fly   272 VSSFVICFVGFQMTVGVPPDIVVKLF----LFLVSSMSQVYLICHYGQLVADASYGF-SVATYNQ 331
            .:    | ||...|:..   |.:|.:    |:|:.:...:|..|..|.||.:::..| ||...|.
  Fly   277 TT----C-VGLLCTISC---IFMKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLSVIYTNC 333

  Fly   332 KWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALL 384
            .||:..|:.::.:::::|::|....|.|.....::.:|...|.:..|.|..:|
  Fly   334 LWYELPVKEEKLIIMMLAKAQNEVVLTAADMAPLSMNTALQLTKGIYSFSMML 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 71/337 (21%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 71/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.