DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or67a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:395 Identity:136/395 - (34%)
Similarity:225/395 - (56%) Gaps:10/395 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEKLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNK-F 64
            ::..::.|..||..:||.||..|   :...:.|.|.|..|:.|:.|....|...:.....||: |
  Fly    15 VDDFLRLAVKFYNTLGIDPYETG---RKRTIWFQIYFALNMFNMVFSFYAEVATLVDRLRDNENF 76

  Fly    65 LEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIR-EERYNLPMYLGTCSRIS 128
            ||:...|||:.||.:|:||:..:..||..:|.|:.:|:..:|:...: :|.|.:..:|..|...:
  Fly    77 LESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSWLKRCHIYT 141

  Fly   129 LIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAG 193
            ..:..|:.::.:...|..:..|::....|:.....:.:|:....||:::|:|.:||..|.|:.||
  Fly   142 KGFGGLFMIMYFAHALIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAG 206

  Fly   194 YTSAAGQISTDVLLCAVATQLVMHFDFLSN-----SMERHELSGDWKKDSRFLVDIVRYHERILR 253
            ||:..|.|:.|:::.||..|::||::.|:.     .::.|......|:|.|.|..:|..|..|||
  Fly   207 YTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGAKEDIRKLQSLVANHIDILR 271

  Fly   254 LSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVA 318
            |:|.:|::|||||||||:.|:.::|.||.|:|:.:.|:...|..|||:|.:.:|||:|.:.|.:.
  Fly   272 LTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYFCKQMLFLISVLLEVYLLCSFSQRLI 336

  Fly   319 DASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFAL 383
            |||.....|.|:..|..:|.|:|:.|:.|..||||...||||:.||::..||:..|.:|||||..
  Fly   337 DASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMSYKFFCA 401

  Fly   384 LRTMY 388
            :||||
  Fly   402 VRTMY 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 110/319 (34%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 110/320 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472765
Domainoid 1 1.000 175 1.000 Domainoid score I7528
eggNOG 1 0.900 - - E1_2EMAZ
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I6052
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 1 1.000 - - otm49922
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.