DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or63a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:392 Identity:85/392 - (21%)
Similarity:174/392 - (44%) Gaps:61/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WSNVINLSFVGLFESIYVYSAFMDNKFLEAV-----TALSYIGFVTVGMSKMFFIRWKKTAITEL 97
            |:.|:::|.:.   |:|.:...: .:::..:     ||.:.:.|:| .::||::..:....|.||
  Fly    45 WTIVLSVSSLA---SLYGHWQML-ARYIHDIPRIGETAGTALQFLT-SIAKMWYFLFAHRQIYEL 104

  Fly    98 INELK--EIYPNGLIREERYNLPM--------------YLGTCSRISLIYSLLYSVLIWTFNLFC 146
            :.:.:  |:.....:.|...:||:              |..:..|..|||  |||.:..|.|.|.
  Fly   105 LRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRRQILIY--LYSCICITTNYFI 167

  Fly   147 ------VMEYWV-----YDKWLNIRVVGKQLPYLMYIPWKWQD-NWSYYPL-LFSQNFAGYTSAA 198
                  :..|:.     ||..|       .||.| |..|:.:. .:.||.: ::.:..:.|....
  Fly   168 NSFVINLYRYFTKPKGSYDIML-------PLPSL-YPAWEHKGLEFPYYHIQMYLETCSLYICGM 224

  Fly   199 GQISTD---VLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSR--FLVDIVRYHERILRLSDAV 258
            ..:|.|   ::||..:..|:...    |.|.....|.....|.|  :|...:..::|:...:..|
  Fly   225 CAVSFDGVFIVLCLHSVGLMRSL----NQMVEQATSELVPPDRRVEYLRCCIYQYQRVANFATEV 285

  Fly   259 NDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPD---IVVKLFLFLVSSMSQVYLICHYGQLVADA 320
            |:.|.......|::|.|......|||:||:..:   .::::.::||::..|:.:.|:.||..|.|
  Fly   286 NNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVYCYNGQRFATA 350

  Fly   321 SYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385
            |...:.|.|..:||.....::..:.:::.|:.:...|..:.|:.::..|:..:::.|.::|.||:
  Fly   351 SEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQ 415

  Fly   386 TM 387
            .:
  Fly   416 NV 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 76/355 (21%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 76/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.