DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or59c

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:384 Identity:77/384 - (20%)
Similarity:148/384 - (38%) Gaps:77/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WSNVINLSFVGLFESIYV--YSAFMDNKFLEAVTA-LSYIGFV---TVGMSKMFFIRWKKTAITE 96
            |..::.|. :|| ...||  :..|...:||.::.. ::.||.|   .|..|:|    |:...:.|
  Fly    57 WLGIVYLP-LGL-SLTYVKHFDRFTPTEFLTSLQVDINCIGNVIKSCVTYSQM----WRFRRMNE 115

  Fly    97 LINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRV 161
            ||:.|.:.......|.      ::....:|::||..|..|    |:..||.:.       |...|
  Fly   116 LISSLDKRCVTTTQRR------IFHKMVARVNLIVILFLS----TYLGFCFLT-------LFTSV 163

  Fly   162 VGKQLPYLMYIP---WKWQDNWSYYPLLFSQNFAGYTSAAGQISTD----VLLCAVATQLVMHFD 219
            ...:.|:.:|.|   |: :.:|..:.....:..........::.:|    |.:......|.:..|
  Fly   164 FAGKAPWQLYNPLVDWR-KGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHLAILRD 227

  Fly   220 FLSN--------SMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSF- 275
            .::|        .||.:|.          :|..::.|..|::.|..:..|..|.:...||:... 
  Fly   228 RIANLRQDPKLSEMEHYEQ----------MVACIQDHRTIIQCSQIIRPILSITIFAQFMLVGID 282

  Fly   276 ----VICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKA 336
                .|..:.|..|:..    ::....|:|:..::.:..|...:.:.:.|...|.|.::..|..|
  Fly   283 LGLAAISILFFPNTIWT----IMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALFHSNWITA 343

  Fly   337 DVRYKRALVIIIARSQK-VTFLKATIF------------LDITRSTMTDLLQISYKFFA 382
            |..||.|::..:.|:|: :.|...:||            ...|..|:.:.:.:..|||:
  Fly   344 DRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFAFTIITIVNQMNLGEKFFS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 67/350 (19%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 65/341 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465964
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.