DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or59b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523822.1 Gene:Or59b / 37715 FlyBaseID:FBgn0034865 Length:398 Species:Drosophila melanogaster


Alignment Length:433 Identity:93/433 - (21%)
Similarity:163/433 - (37%) Gaps:127/433 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EKLMKYASFFYTAVGIRPYTNGEESKMNKLIFHIVFWSNV-INLSFVGLFESIYVYSAFMDNKFL 65
            |.:::|...|:|.|   |:..|            ||:..| ..:|:|..|::      |...:||
  Fly    39 EGVLRYVYLFWTCV---PFAFG------------VFYLPVGFIISYVQEFKN------FTPGEFL 82

  Fly    66 EAVTALS-----YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCS 125
               |:|.     |...|...::.:|..|.:||.|  |::.|.:...|...||..:|:   :..|:
  Fly    83 ---TSLQVCINVYGASVKSTITYLFLWRLRKTEI--LLDSLDKRLANDSDRERIHNM---VARCN 139

  Fly   126 RISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPW-KWQDN----W----- 180
            ...||||.:|          |   .:....:|:..:.|:. |:.:|.|: .|:|.    |     
  Fly   140 YAFLIYSFIY----------C---GYAGSTFLSYALSGRP-PWSVYNPFIDWRDGMGSLWIQAIF 190

  Fly   181 ---------------SYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHEL 230
                           ..|||:|:..|..:...                |..|...|....||.| 
  Fly   191 EYITMSFAVLQDQLSDTYPLMFTIMFRAHMEV----------------LKDHVRSLRMDPERSE- 238

  Fly   231 SGDWKKDSRFLVDIVRYHERILRLSD---------------AVNDIFGIPLLLNFMVSSFVICFV 280
             .|..:|   ||:.|..|:.||:..|               .:..:.|:.|:..|..|:|   :.
  Fly   239 -ADNYQD---LVNCVLDHKTILKCCDMIRPMISRTIFVQFALIGSVLGLTLVNVFFFSNF---WK 296

  Fly   281 GFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALV 345
            |            |...||:::.:.|.:..|:...::.|.:...|...:...|..|:.|||..||
  Fly   297 G------------VASLLFVITILLQTFPFCYTCNMLIDDAQDLSNEIFQSNWVDAEPRYKATLV 349

  Fly   346 IIIAR-SQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            :.:.. .|.:.|:...|| .|:.::...:.:.::....::|.|
  Fly   350 LFMHHVQQPIIFIAGGIF-PISMNSNITVAKFAFSIITIVRQM 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 77/359 (21%)
Or59bNP_523822.1 7tm_6 77..382 CDD:251636 77/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.