DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or59a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:408 Identity:79/408 - (19%)
Similarity:149/408 - (36%) Gaps:110/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITEL 97
            |.:..|.|            :||:.:.:.|    .:..|.|.  |.:|:|               
  Fly    27 FRVENWKN------------LYVFYSIVSN----LLVTLCYP--VHLGIS--------------- 58

  Fly    98 INELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVV 162
                  ::.|..|.|:..||..: .||:..|:      ..|::.:|:..|:|.....:.|:.|||
  Fly    59 ------LFRNRTITEDILNLTTF-ATCTACSV------KCLLYAYNIKDVLEMERLLRLLDERVV 110

  Fly   163 GKQ-----------------------------------------LPYLMYIPWKWQDNWSYYPLL 186
            |.:                                         |.|..:.|:.|..:...|.:.
  Fly   111 GPEQRSIYGQVRVQLRNVLYVFIGIYMPCALFAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIA 175

  Fly   187 FSQNFAGYT-----SAAGQISTDVLLCAVATQLVMHFDFLSNSMERHEL--SGDWKKDSRFLVDI 244
            .:....|.:     :........|:||.:::    |...|.|..|...|  :.|.:||   |...
  Fly   176 NAYQIVGISFQLLQNYVSDCFPAVVLCLISS----HIKMLYNRFEEVGLDPARDAEKD---LEAC 233

  Fly   245 VRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKL-FLFLVSSMS-QV 307
            :..|:.||.|...:.....:|:|:.|.|::..:| :|....|....:.:.:: |:|...:|. |:
  Fly   234 ITDHKHILELFRRIEAFISLPMLIQFTVTALNVC-IGLAALVFFVSEPMARMYFIFYSLAMPLQI 297

  Fly   308 YLICHYGQLVADASYGFS---VATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRST 369
            :..|.:|   .|..|.|.   .|.::..|:..:..:||.:::.:.:|.|.:...|...:.|...|
  Fly   298 FPSCFFG---TDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDT 359

  Fly   370 MTDLLQISYKFFALLRTM 387
            ....|:.:|..|.::..|
  Fly   360 FFSTLKGAYSLFTIIIRM 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 70/366 (19%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 64/321 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.