DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or47b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:365 Identity:83/365 - (22%)
Similarity:151/365 - (41%) Gaps:45/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINE 100
            :||:     .||.|.||         ...:|....|.:|..:.:..:|:|::..:...|.|||::
  Fly    75 IFWT-----MFVALPES---------KNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISD 125

  Fly   101 L----KEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRV 161
            .    :|:.|:.:..|       .||......:|.|.||      .|.||::.::....:|...:
  Fly   126 FEYYNRELRPHNIDEE-------VLGWQRLCYVIESGLY------INCFCLVNFFSAAIFLQPLL 177

  Fly   162 VGKQLPYLMYIPWKWQ----DNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLS 222
            ...:||:....|::|.    ..::::.|...|:.....:....:..|::..:...|..::...| 
  Fly   178 GEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLL- 241

  Fly   223 NSMERHELSGDWK-KDSRF---LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQ 283
             .:|..:| ||.: .|.||   ...:||:|:.|::|....|..|........|.|..:|....|:
  Fly   242 -CIEIRKL-GDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFE 304

  Fly   284 --MTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYN-QKWYKADVRYKRALV 345
              ....|.|.:..|..|.::.:..|:.|.|..|.||...|...:.|.:: ..|:......:|.:.
  Fly   305 TMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDIS 369

  Fly   346 IIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385
            .:|.|:||.....|..||..|..|...:|:..|:..||::
  Fly   370 FVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 73/328 (22%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 73/329 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.