DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or45b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:422 Identity:79/422 - (18%)
Similarity:172/422 - (40%) Gaps:87/422 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FFYT--AVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALS 72
            ||.|  :.|:.....|:|.....|:: :||  |.:||:.....|.::.:|....:. ::|:.|..
  Fly    17 FFVTRYSFGLLGLRFGKEQSWLHLLW-LVF--NFVNLAHCCQAEFVFGWSHLRTSP-VDAMDAFC 77

  Fly    73 YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREE---RYNLPMYLGTCSRISLIYSLL 134
            .:......:.|:.::.|::..:.:|::.::.:......||:   :.....|....:|..::...|
  Fly    78 PLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTL 142

  Fly   135 YSVLIWTFNLFCVMEYWV-------YDKWLNIRVVGKQLPYLMY-------IPWKWQDNWSYYPL 185
            .|:....|.|..:.|.||       :|           :|:.|.       :||        :|:
  Fly   143 GSITTGAFVLRSLWEMWVRRHQEFKFD-----------MPFRMLFHDFAHRMPW--------FPV 188

  Fly   186 LFSQNFAGYTSAAGQIS------TDVLLCAVATQLVMHFDFLSNSMERHELSGDWK-------KD 237
            .:.     |::.:||::      ||.....    ..::..||..:: |:::....|       ::
  Fly   189 FYL-----YSTWSGQVTVYAFAGTDGFFFG----FTLYMAFLLQAL-RYDIQDALKPIRDPSLRE 243

  Fly   238 SRF----LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVIC--------FVGFQMTVGVPP 290
            |:.    |.|||..|..|.::....:.|...|..::|:.:|.||.        :.|:.       
  Fly   244 SKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN------- 301

  Fly   291 DIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVT 355
              :::..::..:..|.::|.|:.|..::..|.....|.|:..||..|...:|.:.:||.|:|:..
  Fly   302 --IIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPI 364

  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            .::...|.. :....|.:::.:....||.:|:
  Fly   365 TVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 62/355 (17%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 62/357 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.