DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or45a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:411 Identity:93/411 - (22%)
Similarity:170/411 - (41%) Gaps:70/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ASFF------YTAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLE 66
            ||:|      ...||..|.|       .:|......|:.::.||.:.....:.|| |..|...|.
  Fly     3 ASYFAVQRRALEIVGFDPST-------PQLSLKHPIWAGILILSLISHNWPMVVY-ALQDLSDLT 59

  Fly    67 AVTALSYIGFVTVGMS--KMFFIRWKKTAITELINELKEI------YPNGLIREERYN-LPMYLG 122
            .:|. ::..|:....|  |...:..|:..|..||:.|.::      .||.|.:.||.| |..|:.
  Fly    60 RLTD-NFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASATPNHLEKIERENQLDRYVA 123

  Fly   123 TCSRISLIYSLLYSVL-----------IWTF---NLFCVMEYWVYDKWLNIRVVGKQLPYLMYIP 173
            ...|     :..|.|:           :|.:   .:|.......::.||:     ::.|:.    
  Fly   124 RSFR-----NAAYGVICASAIAPMLLGLWGYVETGVFTPTTPMEFNFWLD-----ERKPHF---- 174

  Fly   174 WKWQDNWSYYPLLFSQNFAGYTSAAG-QISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKD 237
                    |:| ::.....|..:||. .|:||.|...:...:|:.|..|...:|..:|:|.   |
  Fly   175 --------YWP-IYVWGVLGVAAAAWLAIATDTLFSWLTHNVVIQFQLLELVLEEKDLNGG---D 227

  Fly   238 SRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMT-VGVPPDIVVKLFLFLV 301
            || |...|..|...|.|:..::.|||..:.:.:|:|...:|.:.|:.: .|....:..:. .|||
  Fly   228 SR-LTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFRFSRSGWSAQVPFRA-TFLV 290

  Fly   302 SSMSQVYLICHYGQLVADASYGFSVATYNQ-KWYKADVRYKRALVIIIARSQKVTFLKATIFLDI 365
            :.:.|:...|:.|:.:...|...:.|.|.| .|.:...:.:|...::|.|:|:...:...:|: :
  Fly   291 AIIIQLSSYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRRLWQMVIMRAQRPAKIFGFMFV-V 354

  Fly   366 TRSTMTDLLQISYKFFALLRT 386
            ....:..:::.:..|.|:|||
  Fly   355 DLPLLLWVIRTAGSFLAMLRT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 73/339 (22%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 71/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.