DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or43b

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:277 Identity:60/277 - (21%)
Similarity:121/277 - (43%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPW-KWQ-DNWSYY 183
            :.|.:|:.|.:.::| ||..|..|.        |..|:.||     ||..|.|: .|: |....|
  Fly   134 VATITRLYLTFVVVY-VLYATSTLL--------DGLLHHRV-----PYNTYYPFINWRVDRTQMY 184

  Fly   184 PLLFSQNF----AGYTSAAGQISTDVLLCAVATQLVMHFD---FLSNSMERHELSGDWKKDSRFL 241
            ...|.:.|    |.|.:.|......:.:.|:.|.:::..|   :|.:  ..:|.|.|.....:.|
  Fly   185 IQSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLGD--PSNEGSSDPSYMFKSL 247

  Fly   242 VDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQ 306
            ||.::.|..:|...||:..|....:...|::...::..:...|.:.........:.:::::.:.|
  Fly   248 VDCIKAHRTMLNFCDAIQPIISGTIFAQFIICGSILGIIMINMVLFADQSTRFGIVIYVMAVLLQ 312

  Fly   307 VYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIAR-SQKVTFLKATIFLDITRSTM 370
            .:.:|.|...:.|.....:.|.::..|:..|.||:|.::..:.: .|.:||....|| :|..:|.
  Fly   313 TFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKLQQPMTFTAMNIF-NINLATN 376

  Fly   371 TDLLQISYKFFALLRTM 387
            .::.:.::..:|:...|
  Fly   377 INVAKFAFTVYAIASGM 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 58/266 (22%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.