DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or33c

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:289 Identity:57/289 - (19%)
Similarity:111/289 - (38%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDN-------WS 181
            |..||  :.::|::.     ||.|....:...|        :|.|..|.|:..:.|       ..
  Fly   128 CLYIS--FGMIYALF-----LFGVFVQVISGNW--------ELLYPAYFPFDLESNRFLGAVALG 177

  Fly   182 YYPLLFSQNFAGYTSAAGQISTDVLLCAVA-----------------TQLVMHFDFLSNSMERHE 229
            |.  :||....|:........|.:.||.:|                 .:.|::...|.:.:|:|:
  Fly   178 YQ--VFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHK 240

  Fly   230 LSGDWKKDSRFLVDIVRYHERILRLSDAVN--DIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDI 292
            |             :||:|..:.|....|.  .:.|....|..:| |:::.|||..::      :
  Fly   241 L-------------LVRFHNLVSRTISEVQLVQLGGCGATLCIIV-SYMLFFVGDTIS------L 285

  Fly   293 VVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWY--KADVRYKRALVIIIARSQKVT 355
            |..|..|.|..: |::..|::...||:.......|.::.:||  ..|.|:...:...:....:..
  Fly   286 VYYLVFFGVVCV-QLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGW 349

  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALL 384
            .:||...:::..:.....|:::|..||::
  Fly   350 IIKAGGLIELNLNAFFATLKMAYSLFAVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 54/281 (19%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 54/281 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.