DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or24a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:433 Identity:85/433 - (19%)
Similarity:165/433 - (38%) Gaps:112/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FFYTAVGIRPYTNGEESKMNKLIFHIVFWS--NVINLSFVGLFESIYVYSAFMDNKFLEAVTALS 72
            |..:.:|..|     |.|...|   :..||  |...|:: |.:...|....::......|:.||.
  Fly    22 FALSLIGFYP-----EQKRTVL---VKLWSFFNFFILTY-GCYAEAYYGIHYIPINIATALDALC 77

  Fly    73 YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREER------------YNLPMYL---- 121
            .:....:.:.||..|.|.:..:..||..::      .:.|::            |.|...|    
  Fly    78 PVASSILSLVKMVAIWWYQDELRSLIERVR------FLTEQQKSKRKLGYKKRFYTLATQLTFLL 136

  Fly   122 ---GTCSRISLIYS---LLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQD-- 178
               |.|:..|  ||   |:.::|..|..     :.|:|           :.|:.|..|    |  
  Fly   137 LCCGFCTSTS--YSVRHLIDNILRRTHG-----KDWIY-----------ETPFKMMFP----DLL 179

  Fly   179 -NWSYYPLLF-SQNFAGYTSAAGQISTD---VLLCAVATQLVMHF-----DFLSNSMERHELSGD 233
             ....||:.: ..::.||.:....:..|   :..|...|.|::..     |.|  .:|..|.|..
  Fly   180 LRLPLYPITYILVHWHGYITVVCFVGADGFFLGFCLYFTVLLLCLQDDVCDLL--EVENIEKSPS 242

  Fly   234 WKKDSRFLVD---IVRYHERILRLSDAVNDIFGIPLLLNFMVSSF----------------VICF 279
            ..:::|.:.:   :|..|..:..|::.::.:.....|.:|:.||.                :|.:
  Fly   243 EAEEARIVREMEKLVDRHNEVAELTERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLGIIVY 307

  Fly   280 VGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRAL 344
            |.:...|||                 :::|.|..|..:.:|....:.:|::..||...||.::..
  Fly   308 VVYTCAVGV-----------------EIFLYCLGGSHIMEACSNLARSTFSSHWYGHSVRVQKMT 355

  Fly   345 VIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            ::::||:|:|..:|.. |...:..|:|.:|:.:....||.:::
  Fly   356 LLMVARAQRVLTIKIP-FFSPSLETLTSILRFTGSLIALAKSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 71/366 (19%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 71/367 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.