DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or22c

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:331 Identity:70/331 - (21%)
Similarity:146/331 - (44%) Gaps:61/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 RWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCV--MEY 150
            ||     .||:..|:.|......:|.:..|.....|.:|:||   ||.|....|...|.:  :..
  Fly    99 RW-----AELVQRLRAILWESRRQEAQRMLVGLATTANRLSL---LLLSSGTATNAAFTLQPLIM 155

  Fly   151 WVYDKWLNIRVVGK-QLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQ-------------I 201
            .:| :|: :::.|: :||:.:.:|     :::..|.:|...:...| |:|.             |
  Fly   156 GLY-RWI-VQLPGQTELPFNIILP-----SFAVQPGVFPLTYVLLT-ASGACTVFAFSFVDGFFI 212

  Fly   202 STDVLLCAVATQLV----------MHFDFLS------NSMERHELSGDWKKDSRFLVDIVRYHER 250
            .:.:.:|. |.:||          :|.|.:.      |:..||.|:           .:|..|..
  Fly   213 CSCLYICG-AFRLVQQDIRRIFADLHGDSVDVFTEEMNAEVRHRLA-----------QVVERHNA 265

  Fly   251 ILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQ 315
            |:.....:...|.:.:|::|:.::||:|.....:.:.......:....:::::::|::|.|..|.
  Fly   266 IIDFCTDLTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYICYIIAALTQLFLYCFGGN 330

  Fly   316 LVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKF 380
            .|:::|...:...|:.:|||.|.|.::.:::|:.|||:...: |..|...:...:..:|..:..:
  Fly   331 HVSESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSY 394

  Fly   381 FALLRT 386
            ..||:|
  Fly   395 ITLLKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 67/321 (21%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 67/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465308
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.