DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or22a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:419 Identity:82/419 - (19%)
Similarity:163/419 - (38%) Gaps:75/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SFFYTAVGIRPYTNGEESKMNKLIFHIVFWS----------------------NVINLSFVGL-- 49
            |.|:..:..:|.:...:|:...:....|.||                      |::.|..:.:  
  Fly     3 SKFFPHIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYKLWLAFVNIVMLILLPISI 67

  Fly    50 -FESIYVYSAFMDNKFLEAVTALSYIGFVTVGMS-KMFF--IRWKKTAITELINELKEIYPNGLI 110
             .|.::.:..|...:||.::.    ||....|.| |..|  |.:||....:::  |.::....|.
  Fly    68 SIEYLHRFKTFSAGEFLSSLE----IGVNMYGSSFKCAFTLIGFKKRQEAKVL--LDQLDKRCLS 126

  Fly   111 REERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWK 175
            .:||..:..|:...:...::|.:.||.       |.||.:..:       ::.::..:.||.|:.
  Fly   127 DKERSTVHRYVAMGNFFDILYHIFYST-------FVVMNFPYF-------LLERRHAWRMYFPYI 177

  Fly   176 WQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLV--MHFDFLSNSMERHELSGDWKKDS 238
            ..|. .:|....::.|....:....:.|||  |.:.:.|:  .|...|...: |:..|...:.:.
  Fly   178 DSDE-QFYISSIAECFLMTEAIYMDLCTDV--CPLISMLMARCHISLLKQRL-RNLRSKPGRTED 238

  Fly   239 RFLVDI---VRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMT---------VGVPPD 291
            .:|.::   :|.|..:|...||:..:|...:.:.|::...|:   |..|.         .||   
  Fly   239 EYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQFLLIGTVL---GLSMINLMFFSTFWTGV--- 297

  Fly   292 IVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTF 356
             ...||:|.||  .:.:..|:...::.|.....|...:...|..||.|||..||..:...|:...
  Fly   298 -ATCLFMFDVS--METFPFCYLCNMIIDDCQEMSNCLFQSDWTSADRRYKSTLVYFLHNLQQPIT 359

  Fly   357 LKATIFLDITRSTMTDLLQISYKFFALLR 385
            |.|.....|:..|...::::::....:::
  Fly   360 LTAGGVFPISMQTNLAMVKLAFSVVTVIK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 71/330 (22%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 71/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.