DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and AgaP_AGAP005495

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_556129.1 Gene:AgaP_AGAP005495 / 3289983 VectorBaseID:AGAP005495 Length:416 Species:Anopheles gambiae


Alignment Length:422 Identity:83/422 - (19%)
Similarity:170/422 - (40%) Gaps:83/422 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TAVGIRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFV 77
            |.:||.|   |:...|....:..|::..:: :.::..|.....:...:.|..|......|::...
Mosquito    28 TTMGIWP---GQYVSMRSHWYRRVYYFMLL-MHWLNTFLQTEFFFRNLGNLGLVVQGLCSFVSIT 88

  Fly    78 TVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGT------------CSRISL- 129
            |.|: |:..|...:..|.:|...|::.   ..|::.|:......||            |..:.| 
Mosquito    89 TTGI-KVMRIHAYEAEIVQLWQTLQDA---TFIKKIRFLRKTDRGTIFQRIHQLLARQCKEVQLN 149

  Fly   130 --IYSLL-------YSVLIWTFNLF------CVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDN 179
              .|:|:       ||::....||:      .....:||:                         
Mosquito   150 LRFYTLVVGLVASNYSIIPACSNLYNQFQGNAFNRSFVYN------------------------- 189

  Fly   180 WSYYPLL--------------FSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLSNSMERHEL 230
             :|||||              .|::.:|||:.||.::.|.|..|:..........|.:.:  ||.
Mosquito   190 -TYYPLLEPIKRRSPLFELLFCSESLSGYTTWAGVVAFDGLYVAMVLYAASLMRLLRDLL--HET 251

  Fly   231 SGDWKKDSR---FLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGF--QMTVGVPP 290
            :.....|:.   |..:.:.:|.|.::|.:.:|:||...||:....|:.:||.:.|  .|......
Mosquito   252 ANPGLTDAERAFFQRECILHHIRTIQLIEKINEIFSPVLLVQLFTSTSIICVIAFAASMHADEGD 316

  Fly   291 DIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVT 355
            ...:.:.|:|::::.|::..|.|||.:.:.......:.|:.:|.....|:|....:::..||:..
Mosquito   317 SQTMLMVLYLIAAIYQLFQFCWYGQRLQNEGTELPRSVYDAQWELCAQRFKSTQHVLLLYSQRQI 381

  Fly   356 FLKATIFLDITRSTMTDLLQISYKFFALLRTM 387
            .::|..|..::..|.:.:::.:..:|.:|:|:
Mosquito   382 EMRAWSFSAMSLETFSTIIRSAVSYFTVLQTL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 71/360 (20%)
AgaP_AGAP005495XP_556129.1 7tm_6 73..404 CDD:251636 72/362 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.