DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or85b and Or9a

DIOPT Version :9

Sequence 1:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:369 Identity:82/369 - (22%)
Similarity:158/369 - (42%) Gaps:58/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LSFVGLFESIYVY-------SAFMDNKFLEAVTALSYIGFV-----TVGMSKMFFIRWKKTAITE 96
            |..|.:|.:.:.|       |..:.:.|...:|.:.::.|.     .||:  ::.||    ||  
  Fly    53 LFMVPMFLAAHEYITQVSLLSDTLGSTFASMLTLVKFLLFCYHRKEFVGL--IYHIR----AI-- 109

  Fly    97 LINELKEIYPNG--LIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNI 159
            |..|: |::|:.  :|..|..:..|       :||.|:..:.:.    .:|..::.:|.....:|
  Fly   110 LAKEI-EVWPDAREIIEVENQSDQM-------LSLTYTRCFGLA----GIFAALKPFVGIILSSI 162

  Fly   160 R--VVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLL-------CA---VAT 212
            |  .:..:||:....|:..|....|.|.......|.|::....:..|.||       ||   :|.
  Fly   163 RGDEIHLELPHNGVYPYDLQVVMFYVPTYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAK 227

  Fly   213 QLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVI 277
            ..::|...:..   :.||.|        ||.::..|::.|:::|.:.|.:...:.|.|.:|:..|
  Fly   228 HRMIHLPAVGG---KEELEG--------LVQVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQI 281

  Fly   278 CFVGFQMTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKR 342
            ||:|||:....|....:....|:.|.:..:::....|:.:..||..|....|...|.......||
  Fly   282 CFIGFQVADLFPNPQSLYFIAFVGSLLIALFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKR 346

  Fly   343 ALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRT 386
            ||:|...|:|:...:|. .|.:.:.:|.:.:::.:..:..:||:
  Fly   347 ALLIAAMRAQRPCQMKG-YFFEASMATFSTIVRSAVSYIMMLRS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 75/332 (23%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 76/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.